SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325969830|ref|YP_004246022.1| from Vulcanisaeta moutnovskia 768-28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325969830|ref|YP_004246022.1|
Domain Number 1 Region: 3-240
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 7.59e-71
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000211
Further Details:      
 
Domain Number 2 Region: 228-381
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 5.96e-52
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325969830|ref|YP_004246022.1|
Sequence length 387
Comment acyl-CoA dehydrogenase [Vulcanisaeta moutnovskia 768-28]
Sequence
MPDPFLTEEHQLIRNSVKEFAERYIVPIARKMDLEDYYPRDLIRELSKQGFLTPSAPPEY
GGPGIDLRGSVVVVEELSRYSPTLGFITEIVNDNIVYALLRYGTDRQREEILPKIASGEW
VASYALSEPCCGSDAAAIETRAERRGGEWVINGRKIWITQGAYADIYLLFARTGPKEARH
KAVTAFLVKRSDCVEVSKLEMMGMRGAGEAEVKFNDCVVGDDDVLGKVNEGFRIAMVTLD
LARIGISGVALGLSQGVLDEALEWAKTRTAFGKPLIDWEWVQFQLADIKAKLEIGRTVTY
KAAWLYDNKDPSFVLYASIAKLYTAQMAVEIARDGVQILGGFGYSKESFSERAYRDAKVL
EIAEGTNEVQRMVIYKILTRGLPEVEL
Download sequence
Identical sequences F0QY34
WP_013605681.1.51010 gi|325969830|ref|YP_004246022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]