SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77359127|ref|YP_338702.1| from Pseudoalteromonas haloplanktis TAC125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77359127|ref|YP_338702.1|
Domain Number 1 Region: 144-338
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-56
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000045
Further Details:      
 
Domain Number 2 Region: 423-562
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.01e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000195
Further Details:      
 
Domain Number 3 Region: 7-140
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.96e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00024
Further Details:      
 
Domain Number 4 Region: 340-416
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.66e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77359127|ref|YP_338702.1|
Sequence length 565
Comment sulfite reductase subunit alpha [Pseudoalteromonas haloplanktis TAC125]
Sequence
MSEQDKNVKLSDNERMKRESNFLRGTIATDLKDEITGGFTADNFQLIRFHGMYQQDDRDI
RGERAKQKLEPLHNVMLRARMPGGIIKPEQWLAIDKFAEEKTSYGSIRLTTRQTFQFHGV
LKPNIKGMHQLLDSVGIDSIATAGDVNRNVLCTTNPVESELHQEAYEWAAKISEHLLPKT
KAYAEIWLNGEKAETTEEPILGSNYLPRKFKTTVTIPPNNEVDVHANDLNFVAIAENGKL
IGFNVLVGGGLAMTHGDTATYPRKADDFGFIPLEHTLKIAEHVVSVQRDWGNRSNRKNAK
TKYTLDRVGVDVFKAEVEKRAGVEFASSRPYKFTHRGDRIGWVEGIDGKHHLTLFIQSGR
ILDYPDKPLKTGCRKIAEVHQGDMRMTANQNLIIAGVAANQKAVIEEIARNHGLIDDKDT
EQRKNSMACVALPTCPLAMAEAERYLPSLVEKIEALLAKHGVPNDSIIMRVVGCPNGCGR
AMLAEAGLVGKGPGKYNVYLGGNLEGTRIPKLYLENVGEDVYLAAFDELIGQWVNERNDG
ECFGDFVIRKGIVAEVKVSVTDFHA
Download sequence
Identical sequences Q3IFM1
gi|77359127|ref|YP_338702.1| 326442.PSHAa0155 WP_011326874.1.36504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]