SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15790423|ref|NP_280247.1| from Halobacterium sp. NRC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15790423|ref|NP_280247.1|
Domain Number 1 Region: 47-321
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.27e-58
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 324-520
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.22e-44
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15790423|ref|NP_280247.1|
Sequence length 682
Comment UDP-sugar hydrolase [Halobacterium sp. NRC-1]
Sequence
MRTAMTLLVASLCVLSAAVVPAGAVQASTDAATGTTAPPVATDATTAQANNTTVTILSYN
DIQTAAAENDSLPRLATLVAERRAAHDNPTFVFGAGDEVSPHSLSPLTKWQTPVDTLNVI
DPDAEAIGNHDLDFGFEAVANFSEASTFPWLMANIVDSETGDPIPGTEPYTVVEKQGVRV
GVIGLADQKIKPKTAVDFAEQGYELRDYAAAGSEYATQLRTEEDADVVVVLGHFGVPVAK
QLANETENVDAVLVGDDEIKYPPAETNGVVISEGEARANYLGELNLTVSDGAVTDWEGRL
IDTQNATHNETVSTLIEDARGEELARVAGRTETTLDARFASNYHDETALGNLVTDAFRAK
TGADVAATNAGGIRSNSQYGPGNVTAGNVYNMLPFNNHLVTMRLTGSELTALLESQVETV
GDDGAYDPQAKLQVSGVTYEWATHADADSLVRDVSVNGTPVAPNATYNVTVNSYMAGWDS
VANATVLNEEYTLYGTVLFDYIDAQGTVSPADTDRIRRVDATADAGTVSLDGAGDAAVSF
AMPSTNATVDTQAFYALNAVGERVNATRTTVSDNGTVSVVFPDSSLRTLAADGDGDIDVY
GHYSVAGREYGYFNASVVNADVTATMASSNGTATTVDLTAETDTTTTPPADTDAGTGLPV
PGFGIGVAVLAVFGAALLASRR
Download sequence
Identical sequences B0R5J4 Q9HPZ0
gi|169236159|ref|YP_001689359.1| 478009.OE3017R 64091.VNG1408G gi|15790423|ref|NP_280247.1| WP_010903024.1.1784 WP_010903024.1.50382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]