SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15790452|ref|NP_280276.1| from Halobacterium sp. NRC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15790452|ref|NP_280276.1|
Domain Number 1 Region: 199-387
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.7e-37
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00051
Further Details:      
 
Domain Number 2 Region: 2-176
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.48e-36
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15790452|ref|NP_280276.1|
Sequence length 391
Comment 2',3'-cyclic-nucleotide 2'-phosphodiesterase [Halobacterium sp. NRC-1]
Sequence
MDLYSAVDPDVATFGNHDFDYGPSRTAAVVADSPQTWVSANVYHDGDRVAGVEPWTLVER
DGTTLGFFGVLDADTPALNPMASDLTVTDPIQAATDAEAALRDAGAEYVIALSHLGRGDD
ELAAATTVDAVLGGHIASERVERLDGTLLTRPGAGGDVVFEIDIAADTVTRHQVDNAPRH
DGVTAALRDRLADAGLDAVVGHVTPPMERTERTLFEGESRIGNFVADAYRWAADADVGLQ
NAGGVRDGPALAGDVTVADLVSVVPFAEPVSVAELTGRELLDVFRAGNGSGGLGFAEPDW
WHAHVSGATLEWRDGDGLVSASVGGDPVDPDATYTLATTDYLFYSDDEFPALDAGHRIDQ
LDTQHEVLASYARQEGINPETEGRIRFHADD
Download sequence
Identical sequences Q9HPW1
64091.VNG1450G gi|15790452|ref|NP_280276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]