SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15789800|ref|NP_279624.1| from Halobacterium sp. NRC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15789800|ref|NP_279624.1|
Domain Number 1 Region: 10-177
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.17e-34
Family GHMP Kinase, N-terminal domain 0.00049
Further Details:      
 
Domain Number 2 Region: 184-330
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.45e-32
Family Mevalonate 5-diphosphate decarboxylase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15789800|ref|NP_279624.1|
Sequence length 334
Comment diphosphomevalonate decarboxylase [Halobacterium sp. NRC-1]
Sequence
MRATPPHRRMKATARAHPIQGLVKYHGMRDESLRMPYHDSISVCTAPSNTTTTVEFDPDR
DADQYVVDGDTVTGHGADRIRSVVDAVRDRAGFDHRVRLESQNSFPTNIGLGSSSSGFAA
AALACVRAAGLDLDLPTVSTVARRGSASAARAVTGGFSDLHAGLNDADCRSERLDAPAEF
ASDLRIVVGEVPAYKETESAHAEAADSHMFDARLAHVQGQLAEMRDAVRAGDFQRVFETA
EHDSLSLAATTMTGPSGWVYWKPETLSIFETVRELRADGVPTYFSTDTGATVYVNTTASH
ADEVEAAVADCGVDTAVWEVGGPAHELDERDAIF
Download sequence
Identical sequences Q9HRQ4
64091.VNG0593G gi|15789800|ref|NP_279624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]