SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15790936|ref|NP_280760.1| from Halobacterium sp. NRC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15790936|ref|NP_280760.1|
Domain Number 1 Region: 120-249,507-626
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 9.55e-87
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0000305
Further Details:      
 
Domain Number 2 Region: 316-480
Classification Level Classification E-value
Superfamily GroEL apical domain-like 4.71e-40
Family Group II chaperonin (CCT, TRIC), apical domain 0.0000196
Further Details:      
 
Domain Number 3 Region: 253-322,473-507
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 8.55e-21
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15790936|ref|NP_280760.1|
Sequence length 656
Comment thermosome subunit beta [Halobacterium sp. NRC-1]
Sequence
MMRSVGAVGEPLVVMCVACPRRGGCVVTVVAAAKSCWCRGVSRNLNPGLCPARRVSVRHS
GSCILWCGLPSGRVAAVSLPSDPRRFQRIYIEWQSIYLLNMAQQQRMQGQPMIIMGDDAQ
RVKDRDAQEHNISAARAVADAVRSTLGPKGMDKMLVSSMGDVTVTNDGVTILQEMDIDNP
TAEMIVEVAETQEDEAGDGTTTAVAIAGELLKNAEDLLERDIHPTAIIKGYNLAAEQARE
EVDNVAVDVDPDDKDLIRSVAETSMTGKGAELDKELLSSIIYDAVNQVAVETNDGGIVVD
AANINIETQTGHGVNESQLLRGAAISKDPVHDQMPAAVEDADVLLLNEAIEVEEAEADTS
VNIESPDQLQSFLDQEEKQLKEKVQQIADTGANVVFCQKGIDDMAQHYLAKEGILAVRRT
KKSDIEFLTNVLDASVVTDLDAASEADVVAGSVTRDSDDELFYVEGESEQAHGVTLLLRG
STDHVVDELERGVSDALDVSAQTLSDGRVLPGGGATEVEVASRLRDFADSVSGREQLAVE
AFADSLELVPRVLAENAGLDSIDTLVDLRSAHENDDDEHIGLNVLSGDLEDTFEAGVVEP
AHAKEQAVTSASEAANLVLKIDDIISAGDLSTDKGDDDGGAGGMGGGMGGGMGGMM
Download sequence
Identical sequences 64091.VNG2096G gi|15790936|ref|NP_280760.1| HsR182 WP_010903542.1.1784 WP_010903542.1.50382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]