SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|83649140|ref|YP_437575.1| from Hahella chejuensis KCTC 2396

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83649140|ref|YP_437575.1|
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.83e-20
Family N-acetyl transferase, NAT 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83649140|ref|YP_437575.1|
Sequence length 162
Comment histone acetyltransferase HPA2-like acetyltransferase [Hahella chejuensis KCTC 2396]
Sequence
MKIRRAFSEECVVLSEIAMESKAVWGYSQEFMDACQAELTYSEDYMSRHTVYTAVARSGE
IAGFYSLRALSPVCTEMDALFVRPDYMRQGVGRALIEHAVLWAYQCGYHLMMIQGDPNAA
GFYQTFGATLIGYADSTRFPGRKLPLFQIALIDQVSAISASL
Download sequence
Identical sequences Q2S874
WP_011400202.1.94453 349521.HCH_06509 gi|83649140|ref|YP_437575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]