SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|83646469|ref|YP_434904.1| from Hahella chejuensis KCTC 2396

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83646469|ref|YP_434904.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000108
Family N-acetyl transferase, NAT 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83646469|ref|YP_434904.1|
Sequence length 150
Comment acetyltransferase [Hahella chejuensis KCTC 2396]
Sequence
MNFHIRNEQPSDLDAITQVTEQAFLNAPHTSHTEHLVVNALRSRGKLTISLVAEEQGELV
GHIAISPVTIQGDDNSGRPGSASTPNWYGLGPVSVRPDRQGDLLIRQTNSFLLFVCNDRA
CTGQALSPAARRRAGASMRLMINMPISLPY
Download sequence
Identical sequences Q2SFU5
WP_011397547.1.94453 gi|83646469|ref|YP_434904.1| 349521.HCH_03745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]