SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389851753|ref|YP_006353987.1| from Pyrococcus sp. ST04

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389851753|ref|YP_006353987.1|
Domain Number 1 Region: 247-598
Classification Level Classification E-value
Superfamily SIS domain 6.68e-109
Family double-SIS domain 0.000000127
Further Details:      
 
Domain Number 2 Region: 2-230
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.72e-76
Family Class II glutamine amidotransferases 0.00000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389851753|ref|YP_006353987.1|
Sequence length 598
Comment glucosamine-fructose-6-phosphate aminotransferase [Pyrococcus sp. ST04]
Sequence
MCGIIGYIGPKRASPIIVEGLKRLEYRGYDSAGIATCYEGRIFIKKGAGKINELIKKLKL
QELPGNIGIGHTRWATHGVPNDINAHPHTDCTGKIAVVHNGIIENFQELKEELLKKGHVF
KSDTDTEVIAHLIEENLRITKNFEDAFRMTLLRLRGSYALVVLFADDPERLYIARKDSPL
IIGIGNGEMFIASDIPAFLAHTRKAVFLDDGEYGVVHKDWFQIRDIVTGLPKVKHVHEIS
WTLEMAEKGGYEHFMLKEIFEQPRAIKDAVYGNIEVIDKVAELVSKYERIIIIGMGTSYH
AALVGKYLIQRMGRTPVIVEDASEFRYEYENIIDESSLVIAITQSGETADTVAAMKLAKS
KGAKVVGIVNVVGSLATRIADMTLYTHAGPEIGVAATKTYTTQLTVLTLLSLSLAKRIGI
DVQSIEKHIPRLPEIVDSVLKFDEKIKTLAHELKGKRDFFYIGRGISVPTALEGALKIKE
IAYVHAEGLSAGELKHGPLALIEEGVPVVAVAPSGKVFEKMLSNIEEAKARGGHIISLGD
DIRLSNVSDVFLRMPRVPEELSPIVYVVPLQLLAYHLAVIKGHNPDRPRNLAKSVTVE
Download sequence
Identical sequences I3RCF2
WP_014733438.1.16002 gi|389851753|ref|YP_006353987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]