SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389851999|ref|YP_006354233.1| from Pyrococcus sp. ST04

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389851999|ref|YP_006354233.1|
Domain Number 1 Region: 2-322
Classification Level Classification E-value
Superfamily SIS domain 3.05e-59
Family double-SIS domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389851999|ref|YP_006354233.1|
Sequence length 323
Comment glucosamine-6-phosphate deaminase [Pyrococcus sp. ST04]
Sequence
MHATLNEIRRTPEGILKAQEAFEKVKDVKLPRKILYTGCGSSHFLSQLLAMATNKLGGRG
FALPCSELMYARDYYPIEQPGLLVAISRSGETTEVLKAMDMLDVRKMGITAYESSLSKKA
DYALVVETPEDSVVMTHSFQAFYFAYIQLLRKSYDLETFNAEHVSELTKDVLGNESYIRD
IIEEFEFSNVIFLGSGILYPVALEAMLKMKEMAIFWSEAYPMFEVRHGFKSIADSNSLVV
MFVPSPFDWHEKLVKEFQGQGAKVFVIGKEELGADYFIKLLEVDELLQPVIVLPLIQLLA
YYKAVKRGMNPDNPRFLDKVVRW
Download sequence
Identical sequences I3RD48
WP_014733684.1.16002 gi|389851999|ref|YP_006354233.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]