SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33151897|ref|NP_873250.1| from Haemophilus ducreyi 35000HP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33151897|ref|NP_873250.1|
Domain Number 1 Region: 24-497
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.31e-110
Family Pyridoxal-dependent decarboxylase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33151897|ref|NP_873250.1|
Sequence length 511
Comment L-2,4-diaminobutyrate decarboxylase [Haemophilus ducreyi 35000HP]
Sequence
MTDISKHRQALFCSDAQSIADYQNAMNNAVLAVSEWLKNDKMYTGGSIKQMRTLIDGFNP
SKNGVGVQKSLEKLVEIFLNPSLKVHHPHSLAHLHCPTMVTSQIAEVLINATNQSMDSWD
QSPAGSIMEEHLIDWLRHKVGYGQGTAGVFTSGGTQSNLMGVLLARDWAIAKHWQHDDGT
EWSVQANGIPAAAMQTVKVVCSENAHFSVQKNMAMMGMGFQSVVTVPSNANAQMDLDALA
KTLADLKASGNIVACIVATAGTTDAGAIDDLTAIRKLADEYQAWLHVDAAWGGALLLSKD
FRHFLNGIELTDSITLDFHKHFFQSISCGAFLLKDPANYRFIDYKADYLNSEYDEAHGVP
NLVAKSLQTTRRFDALKLWFTIDALGENLYASMIDHGVYLSRQVEAYINATYNLEMLVPA
QFASVLFRVVPKGYPQELIDTLNQNVADELFARGEANIGVTKVADKQSLKMTTLSPIATF
ENVKALLEQVLAEAERIKDAIAQGTYVPPID
Download sequence
Identical sequences Q7VN56
WP_010944691.1.19715 WP_010944691.1.2534 WP_010944691.1.34146 WP_010944691.1.41579 WP_010944691.1.69448 WP_010944691.1.70555 WP_010944691.1.77494 WP_010944691.1.78970 WP_010944691.1.84729 WP_010944691.1.91697 WP_010944691.1.99406 gi|33151897|ref|NP_873250.1| 233412.HD0726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]