SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337284089|ref|YP_004623563.1| from Pyrococcus yayanosii CH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337284089|ref|YP_004623563.1|
Domain Number 1 Region: 258-396
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.41e-16
Family MJ1460-like 0.015
Further Details:      
 
Domain Number 2 Region: 4-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000383
Family RecA protein-like (ATPase-domain) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337284089|ref|YP_004623563.1|
Sequence length 403
Comment hypothetical protein PYCH_06030 [Pyrococcus yayanosii CH1]
Sequence
MEGEFIKSGVERLDQILGGGFRKGYNVAVVGGLDGDNVLFLHNLVYSLLSQDYRILLVEF
RQEPSHLFSWLKSFGIDYEKAVEEGKLKIIDGFSNLYFPTPISKEENVLPNPLDLSITTA
LIRDSIVRDSYNFLVLDDLSILYTLQADPKVYVRVMVRLVNSIKKFGAQTIASLNSDVFS
SKDLATLLVPFEYVIDVREGTAKVARSPYPLSSPQNCFPYTKAKNGIVPLSEAYENLEVL
KNSLKLDDEGNLWLGTERVQIVVEESEASLVEFVYNYLGPEEGERFLYLWGKWEFKGYGS
LIRKKHENLEDALMGLLSTTKVLGGGHLEFVQMTDELIVLRGKNLFPRIERFPYHAHVNY
AGAIAQFVEDFTGEKWEGKEVRCQGQGASHCEFVIKKVKDKRI
Download sequence
Identical sequences F8AI64
WP_013905348.1.67208 gi|337284089|ref|YP_004623563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]