SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54302830|ref|YP_132823.1| from Photobacterium profundum SS9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54302830|ref|YP_132823.1|
Domain Number 1 Region: 114-285
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-45
Family Histidine kinase 0.00083
Further Details:      
 
Domain Number 2 Region: 454-574
Classification Level Classification E-value
Superfamily CheY-like 1.12e-36
Family CheY-related 0.0039
Further Details:      
 
Domain Number 3 Region: 47-126
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.35e-23
Family Homodimeric domain of signal transducing histidine kinase 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|54302830|ref|YP_132823.1|
Domain Number - Region: 23-58
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.033
Family Outer membrane lipoprotein 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|54302830|ref|YP_132823.1|
Sequence length 578
Comment hypothetical protein PBPRB1151 [Photobacterium profundum SS9]
Sequence
MYPNDVKIEEDHNAALKVKSDGNDEFTVFTSKLNQLLEDRHFSQANIIKAKEEAEKANAA
KSSFLANMSHEIRTPLNGIIGMSGILSDTELNPSQAEYLQTIETSSQTLLLLINDILDLS
KIESGNLVLSPHESNLAEVVYDTITIVQAKASEQGLNLQIQLDPELPTSVMLDEHRLRQV
LMNLMSNAVKFTLQGSVTLSITYTDIGDKKASLLFSIKDTGIGIEKDKQQQVFAPFTQED
GSITRQFGGTGLGLAICRQLVELLGGSIELKSEKGVGSDFYFSLDVDVVKYQPKIISNFE
NKKCLLLSNQSSNAELIEIECKKWGLNVTISDIETAAVSGISQQYDLILYCQKTLNRTIK
DIELFNRIQERPALVICSQLQDEQFDFGHTIDGLTILPLLGQRFVKAINSAFTNVLKNSE
IQTKSALNPDSRLIDIKPVSINTTPVITESQDVILIVEDNIVNQKVASLLLKKAGYQIVV
ANNGQEAVDLITQKEPTLFKAILMDCMMPIMDGFAATEAIRLWEKEQHTDRLPIIALTAS
VLDEDISKCYEAGMDDYVAKPFRKEHLLDKLERLNEVA
Download sequence
Identical sequences Q6LI57
298386.PBPRB1151 gi|54302830|ref|YP_132823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]