SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54303651|ref|YP_133644.1| from Photobacterium profundum SS9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54303651|ref|YP_133644.1|
Domain Number 1 Region: 553-1036
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-126
Family ALDH-like 0.000000516
Further Details:      
 
Domain Number 2 Region: 190-538
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.31e-110
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000536
Further Details:      
 
Domain Number 3 Region: 17-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 3.66e-65
Family N-terminal domain of bifunctional PutA protein 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|54303651|ref|YP_133644.1|
Sequence length 1041
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Photobacterium profundum SS9]
Sequence
MFNAADVLQPSFIERPLNEIWTLISPLYSVDESLWLEQLLPLAEPSDIERKHTTDKAAEL
IQRVRADKNAIQMIDALLLEYSLDTKEGILLMCLAEALMRIPDAATADALIRDKLSVADW
KSHLKNSDSLFVNASTWGLMLTGKVVTMDAKEDGKPSHVINRLVNKMSEPVIRQAMNQAM
KIMGHQFVLGRTISEAMKNGKSNRDKGFTYSFDMLGEAALTAQDAQKYFKDYIMAVESVG
RDEYASQKGSNQQSPDPTVSIKLSALHPRYDVANEARVLDEMYESVLTLLSRARELNVGI
TIDAEEADRLELSLKLFEKLYRSDAVKGWGRFGIVVQSYSKRALPVLAWLAALSKAQGDI
IPLRLVKGAYWDSELKLSQQSGFSDYPVFTRKESTDSAYLACARFLLSEHLRGVIYPQFA
SHNAHTISAIVAMTDHRDFEFQRLHGMGDALYNHAMDMYQANVRIYAPVGSHKDLLPYLV
RRLLENGANSSFVHRLVDANCPIESLTEHPVDTLRSRPSLNNSLIPLPPQIFGESRKNSA
SINIDIESEWTPFNAAIQAFSQHQWQAGPIVNGVTLDGEQHAITAPYNRSESVGQVAFSS
ASQVAQAIDVASEAYPAWSQVAASERGECLQRLADLLELHTGELVALCHREAGKTIQDSI
DEIREAVDFCRFYGEQASSELASAKSIKSFDGSTKQLTYQGRGVFACISPWNFPLAIFLG
QVSAALAAGNTVVAKPAEQTSLIAYRAIELMLEAGIPAGAIQLLPGTGAEVGATLTTDVR
IAGVAFTGSTETAQRINRSLVARDCEAVPFIAETGGQNAMIVDSTALPEQVVRDVVRSAF
ASAGQRCSALRVLFVQADIADRIITLIKGAMAELSVGRPELHSTDVGPVIDIAAKEKLLT
HIESLKNQSTLVAQTQLSDECKLGDFVAPTAFEINSIDILKNENFGPILHIVRFKANEID
QVVDQINHTGFGLTLGVHSRNERTYCRIEQRARVGNCYINRDQVGAVVGVQPFGGQGLSG
TGPKAGGPHYLYRFTKDVLSA
Download sequence
Identical sequences Q6LFT6
298386.PBPRB1999 gi|54303651|ref|YP_133644.1| WP_011221978.1.54600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]