SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54307484|ref|YP_128504.1| from Photobacterium profundum SS9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54307484|ref|YP_128504.1|
Domain Number 1 Region: 22-293
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 9.42e-94
Family Methylenetetrahydrofolate reductase 0.00000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|54307484|ref|YP_128504.1|
Sequence length 299
Comment 5,10-methylenetetrahydrofolate reductase [Photobacterium profundum SS9]
Sequence
MGYSHASHLDSLNQNIADINGDINVSFEFFPPSSEKMEETLWHSIHRLKTLKPKFVSVTY
GANSGERDRTHSIIKDIKDQTGLIAAPHLTCIDASRDELRTIARDYWRNGIRDIVALRGD
LPAQGTKPDMYAADLVELLRKEADFDISVAAYPEVHPEAKSAQADLINLKRKVDAGASRA
ITQFFFDVESYLRFRDRCVAAGIDVEIVPGILPVSNMTQAKRFAVANNVKIPGWLEKQYQ
GLDDDLLSRQMLGASNAIDMVRVLSREGVKDFHFYTLNRAELTYAICHTLGVRAEVEAK
Download sequence
Identical sequences Q6LVH3
gi|54307484|ref|YP_128504.1| 298386.PBPRA0263 WP_011217076.1.54600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]