SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54308320|ref|YP_129340.1| from Photobacterium profundum SS9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54308320|ref|YP_129340.1|
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 8.11e-56
Family Molybdopterin synthase subunit MoaE 0.00000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54308320|ref|YP_129340.1|
Sequence length 149
Comment molybdenum cofactor biosynthesisprotein E [Photobacterium profundum SS9]
Sequence
MISVQFEDFSVAEEYALLSAGTDAGAVVTFIGKVRDFNHGDDVTGLTLEHYPGMTEKSLE
EIVVQARERWPLLKTRVIHRVGDLGLGDQIVFVGVTSAHRGAAFEACEFIMDFLKTRAPF
WKKEQTSNETRWVDARDTDTSAAERWHKK
Download sequence
Identical sequences Q6LT38
gi|54308320|ref|YP_129340.1| 298386.PBPRA1127 WP_011217870.1.54600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]