SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54310006|ref|YP_131026.1| from Photobacterium profundum SS9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54310006|ref|YP_131026.1|
Domain Number 1 Region: 64-200
Classification Level Classification E-value
Superfamily CBS-domain pair 6.7e-34
Family CBS-domain pair 0.0019
Further Details:      
 
Domain Number 2 Region: 201-285
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.31e-23
Family CorC/HlyC domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|54310006|ref|YP_131026.1|
Sequence length 290
Comment hemolysin [Photobacterium profundum SS9]
Sequence
MNEDNPQNSEGPSRKSFFERIGQLFQGEPQNREELVEVFRDSEENDLIDHDTRDMLEGVM
EIAEMRVRDIMIPRSQIITIERSQKLEDLINLIVDAQHSRYPVISDDKDHVEGILLAKDL
LRYLLPESEPFDMAKVLRPAVVVPESKRVDRLLKEFREERYHMAIVVDEFGGVSGVITIE
DILEQIVGEIEDEFDDEEEQEIRQLSKHTYAVKALTTIDDFNDMFQTTYSDEEVDTVGGL
VMTSFGHLPSRGEVVELGGYSFKVTSADNRRVIQLQVTVPNKAYQPTITS
Download sequence
Identical sequences Q6LNA2
gi|54310006|ref|YP_131026.1| WP_011219496.1.54600 298386.PBPRA2881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]