SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|68249429|ref|YP_248541.1| from Haemophilus influenzae 86-028NP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68249429|ref|YP_248541.1|
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.01e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0000105
Further Details:      
 
Domain Number 2 Region: 108-240
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.01e-28
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|68249429|ref|YP_248541.1|
Sequence length 256
Comment fumarate reductase iron-sulfur subunit [Haemophilus influenzae 86-028NP]
Sequence
MANSPVMNVEVLRYNPEIDQEPHLSTYQVPYDNQTSLLDALGYIKDKLEPSLSYRWSCRM
AICGSCGMMVNNKPKLACKTFLRDYSGHMRIEPLANFPIERDLVVDLSHFIESLEAIKPY
IIGNEAPALDGKPHPSKELQVSRTKQTPAQLEKYRQFSMCINCGLCYAACPQFGLNPEFL
GPAAITMAHRYNLDNRDHGKAKRMSLLNGKNGVWSCTFVGYCSEVCPKHVDPASAINQGK
VESAKDYVISMLKPKG
Download sequence
Identical sequences A0A0D0H1C6 A0A0E1SQS9 A0A0E1WVW3 A0A0Y0B9B5 A4N377 A4NX46 E1XBD8 F2C0C5 F9H282 P44893 Q4QM66
gi|16272775|ref|NP_438994.1| gi|68249429|ref|YP_248541.1| gi|378697035|ref|YP_005178993.1| gi|386264726|ref|YP_005828219.1| gi|148826521|ref|YP_001291274.1| NP_438994.1.63031 WP_005639269.1.10621 WP_005639269.1.12329 WP_005639269.1.13610 WP_005639269.1.14659 WP_005639269.1.15261 WP_005639269.1.17459 WP_005639269.1.20018 WP_005639269.1.20853 WP_005639269.1.23149 WP_005639269.1.23920 WP_005639269.1.25413 WP_005639269.1.25656 WP_005639269.1.26667 WP_005639269.1.27712 WP_005639269.1.28397 WP_005639269.1.32414 WP_005639269.1.32618 WP_005639269.1.32982 WP_005639269.1.34722 WP_005639269.1.34925 WP_005639269.1.37003 WP_005639269.1.37452 WP_005639269.1.38938 WP_005639269.1.39279 WP_005639269.1.39974 WP_005639269.1.40038 WP_005639269.1.40040 WP_005639269.1.40343 WP_005639269.1.40503 WP_005639269.1.40942 WP_005639269.1.42240 WP_005639269.1.42267 WP_005639269.1.42821 WP_005639269.1.43923 WP_005639269.1.45125 WP_005639269.1.46862 WP_005639269.1.48995 WP_005639269.1.50588 WP_005639269.1.50795 WP_005639269.1.51509 WP_005639269.1.5387 WP_005639269.1.53947 WP_005639269.1.54653 WP_005639269.1.54661 WP_005639269.1.55069 WP_005639269.1.56005 WP_005639269.1.56181 WP_005639269.1.57183 WP_005639269.1.57312 WP_005639269.1.58856 WP_005639269.1.59352 WP_005639269.1.59529 WP_005639269.1.6054 WP_005639269.1.61635 WP_005639269.1.62109 WP_005639269.1.62697 WP_005639269.1.63539 WP_005639269.1.64134 WP_005639269.1.67509 WP_005639269.1.71424 WP_005639269.1.74023 WP_005639269.1.74240 WP_005639269.1.74810 WP_005639269.1.75193 WP_005639269.1.75514 WP_005639269.1.75525 WP_005639269.1.76348 WP_005639269.1.76410 WP_005639269.1.76737 WP_005639269.1.78014 WP_005639269.1.79564 WP_005639269.1.80605 WP_005639269.1.81823 WP_005639269.1.82376 WP_005639269.1.82381 WP_005639269.1.85244 WP_005639269.1.85362 WP_005639269.1.86649 WP_005639269.1.8829 WP_005639269.1.88810 WP_005639269.1.90238 WP_005639269.1.90320 WP_005639269.1.90586 WP_005639269.1.91188 WP_005639269.1.91647 WP_005639269.1.91769 WP_005639269.1.92138 WP_005639269.1.92858 WP_005639269.1.93392 WP_005639269.1.93908 WP_005639269.1.94547 WP_005639269.1.94621 WP_005639269.1.94624 WP_005639269.1.9601 WP_005639269.1.96546 WP_005639269.1.9694 WP_005639269.1.9761 WP_005639269.1.97721 WP_005639269.1.99326 WP_005639269.1.99776 281310.NTHI1000 374930.CGSHiEE_07890 71421.HI0834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]