SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CHGT_00874 from Chaetomium globosum CBS 148.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CHGT_00874
Domain Number 1 Region: 5-302
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.97e-83
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000081
Further Details:      
 
Domain Number 2 Region: 486-736
Classification Level Classification E-value
Superfamily ITPase-like 6.54e-35
Family Maf-like 0.00015
Further Details:      
 
Domain Number 3 Region: 303-399
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.000000000000311
Family Anticodon-binding domain of Class II aaRS 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CHGT_00874
Sequence length 758
Comment | CHGG_00874 | Chaetomium globosum hypothetical protein (759 aa)
Sequence
MTSVYSPGSPILLPNGARIFNRLIDFLRQQYVRYGFQEVITPTIYKKALWAKSGHLENYS
DDMYTVTSTSPSRAEVTDRGEEAEYGLKPMNCPGHCLIFASQTRSYRDLPIRYADFSPLH
RNEISGALSGLTRVRRFHQDDGHIFCRPSQIRDEIAKTLDFVRLTYGVLGLGPYRLVLST
RPEQYIGSEEDWTQAESALREALVGSRLQYTINPGDGAFYGPKIDIILKDSDGKEHQTAT
IQLDFQLPKRFNLEYTAPAPEFEKRGAITTDAELLAEYGPVQPVLIHRAVLGSAERLMAL
LIEHYKGKWPFWLNPRQAIVITVNNSEPVANWARQTRDILLGVSASTSTIEAASPTGLAI
DIDDSNRGVELKVREAKTKGYGLIIGVGPRDVETKTVGVNATSLAKPDATFHEIKKLKRI
DMSPAKLRDYMLSSIKYNAMDLSNPSDPPPDYITAARAHGIPLRQSAPIKKGPFPLELPI
LTHLRSKRVILASASPRRKALLAQVSIHHSPPCPFPLPSSQRTLLTTPNPQIGLTNLEII
PSTEPEDLDKKTHTPEEYVAATARRKCLAVYQTALTRQQEATEHKQKQDVPNPVPDPRVL
EDPAVVIAADTVIATRGGQILEKPRSEADHVRMLTHLRDTIRHRVLTAVCVLAPKADATH
PGYEIASHVEGTNVFFAGADDGLPDDVIESYVRTREGADKAGGYALQGVGGMVLVDKVEG
SVDNVIGLPVRKCLQLCERVVFRQGEEVEGEDGEGDEE
Download sequence
Identical sequences Q2HFY0
CHGT_00874 XP_001220095.1.25026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]