SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CHGT_07793 from Chaetomium globosum CBS 148.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CHGT_07793
Domain Number 1 Region: 9-187
Classification Level Classification E-value
Superfamily ITPase-like 9.16e-58
Family ITPase (Ham1) 0.00000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CHGT_07793
Sequence length 191
Comment | CHGG_07793 | Chaetomium globosum conserved hypothetical protein (192 aa)
Sequence
MTTPTAARHMVNFITGNTNKLCEVRAILQPAIQVESQTLDLIEIQGTLEEVTLDKCRRAA
DLVEGPVLVEDTCLCFNALNGLPGPYIKWFMKSLGHTGLNNLLAAYEDKSAQAVCTFAYS
AGPGHEPILFQGITDGKIVPARGPGDFGWDAIFEYEGQTYAEMDKAAKNKISHRYRALAK
LQEWFAKEMAP
Download sequence
Identical sequences Q2GW61
CHGT_07793 XP_001225449.1.25026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]