SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32266892|ref|NP_860924.1| from Helicobacter hepaticus ATCC 51449

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32266892|ref|NP_860924.1|
Domain Number 1 Region: 83-175
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.57e-34
Family Ribosomal protein L6 0.0000628
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.58e-20
Family Ribosomal protein L6 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32266892|ref|NP_860924.1|
Sequence length 178
Comment 50S ribosomal protein L6 [Helicobacter hepaticus ATCC 51449]
Sequence
MSRVGKKPINIPKGVEVSVQGSKILFKGAKEQKELETYGRVQIHLQDGTLSFACVDSQAQ
SRAYWGTYRALANNIIVGLSQGFTKVLEINGVGYKANISGKNLEMALGFSHPVIYPIPAG
VEMSVDKNTITIKGADKQQIGQIAAEIRKFRPPEPYKGKGIKYSDEMIVRKAGKTSKK
Download sequence
Identical sequences A0A099BNR9 Q7VGC9
235279.HH1393 gi|32266892|ref|NP_860924.1| WP_011116233.1.5593 WP_011116233.1.84735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]