SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_00706T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_00706T0
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.16e-43
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000563
Further Details:      
 
Domain Number 2 Region: 190-344
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.2e-37
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000923
Further Details:      
 
Domain Number 3 Region: 379-554
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.48e-36
Family Pyruvate oxidase and decarboxylase PP module 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SJAG_00706T0
Sequence length 573
Comment | SJAG_00706 | Schizosaccharomyces japonicus yFS275 2-hydroxyacyl-CoA lyase (574 aa)
Sequence
MKKTCSEVIAETLVSLQVKYVFGIVGIPVIQVAEAIRDAGIHFVSFRNEQSAAYAATAYA
YLTKKPAFCLVVGGPGVIHAMAGVFNANNNRWPLVLLAGSSETSLRHMGAFQEFDQVSFL
TPHTKFAARPPSIQLLPSYIQRAYRVSHFGTPGTAYVDLPADLIESSTASEDICIPSPSN
ILDSPVVNAAEDVLNKVADILIHAKAPLIVVGKGVAYSKAEDAVYNLVEKSGIPFLPTPM
GKGCIPETHPLNASAARSSALKSADVVILLGARLNWLLHFGKQPRWSQTVRFIQVDTCAE
ELGNNTSLGSTFVWADIACFANQLSTLLEKKGYKRSPSVAQYVNSLAAVRKKNEQKALNQ
LQSSTPLRMNYSLHVMNEVLTLLSKNSSTPVTWVSEGANTMDRSRLLLHVSHARGRLDAG
TTSTMGLGMGYSIATALANPNHRVVSVFGDSAFGFSAMEVETAIRNKLNIIIIILNNNGI
YHGLDADSYKDLEEKNQLPTTALSVATRYDAICQACGGQGFFVQTEQELKDALTTAWKTN
NVSLINVMIDPESKMKLVSVTKYSTHPLTILDI
Download sequence
Identical sequences SJAG_00706T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]