SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_02006T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_02006T0
Domain Number 1 Region: 73-392
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.88e-97
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SJAG_02006T0
Sequence length 406
Comment | SJAG_02006 | Schizosaccharomyces japonicus yFS275 pyruvate dehydrogenase E1 component subunit alpha (407 aa)
Sequence
MSFARSIRSARSMGRMLQTTRSVVPGFRTVTTAAATTSGDAAAVPEDGDKPFTVRVHDDA
YEAYKMDVPSLDLEVTKNELLKMYQDMVAVRRLELAADGLYKAKKIRGFCHLSVGQEAVA
VGMENAIEPEDKIITSYRCHGLAYMRGVAVRAIIGELLGREVGVSKGKGGSMHMFGPNFY
GGNGIVGAQVPLGAGLAFAQKYMNKPNVTFAMYGDGAANQGQVFEAFNMAKLWGIPAIFT
CENNKYGMGTSAERSSAMTEYYKRGQYIPGLRVNGMDVLAVKRACKYLKDFALKNQTPLV
VEFVTYRYGGHSMSDPGTTYRTREEIQKVRATKDPIEGLKRQIMEWGVANANELKSLEKK
VRAFVDDEVAAAEASPFPEATRANLFADIYAKGTEPKYFRARTELE
Download sequence
Identical sequences B6JZG7
SJAG_02006T0 XP_002173228.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]