SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_02230T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_02230T0
Domain Number 1 Region: 46-380
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.17e-61
Family TK-like PP module 0.038
Further Details:      
 
Domain Number 2 Region: 425-617
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.83e-17
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.073
Further Details:      
 
Domain Number 3 Region: 623-764
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000267
Family Transketolase C-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SJAG_02230T0
Sequence length 822
Comment | SJAG_02230 | Schizosaccharomyces japonicus yFS275 xylulose-5-phosphate phosphoketolase (823 aa)
Sequence
MKFEATKEFMNESRTEAAKADPSPLQSHLPATLDTLQVHLLKDYVPEDDLVTLKNFQRVC
NYIAAAMIFLCDNVLLENKLTSDHIKPRLLGHWGTCPALALAYSHCNRIISKYNLDMLFV
TGPGHGAPAILAALYIEGSLQAYYPQYGHNMQGLHRLITKFSVTGGFPSHVNAEVPGAIH
EGGELGYALSVSYGAVLDRPNLIVACVVGDGEAETGPTAASWHCHKFIDPAESGAVIPIL
NLNGFKISERTVYGCMDRRELSALFSGFGYQVVFVDYRTADDVNRDMAAAMDWCVEIIHE
IQDAARAGTPIIKPRWPMIILHTPKGWGCPKTLHGKPLEGTFRAHQVPLKNAKTDAEELG
QLENWLKSYHIEDFIDKSNGLPLKGLIEHLPPRVKRMGQKTDANNDFQPLCVPDWNDFSI
DRGILESATSIVGKYLDRVLQANPKTLRLFSPDELASNKLDGVLEHSNRTLQTDAISAWS
RGRVTEVLSEHMCQGFMQGYTLTGRTAIFPSYEAFLPIITSMTVQYTKFLKMALETKWHG
RVGSLNYVTTSTWARQEHNGFSHQSPRFITTMLSFKPTLTRVYFPPDTNCFLSTIAHCLS
SDNGVNLMVSSKNPGPSWLSREEAEEHCVAGASVWKFASTDGGLDPDVVLVGIGNEIMFE
VIAAASILAHDLPKLRIRVVNITDLMILADNHPHSMSEIEFNALFTPNRHVHFNYHGYVM
DLQSLLFSRIDASRVSMEGYCEEGTTTTPFNMMIANRTSRYHVAMAAVAGATCNPEVAMN
CHKLISNYKHRLTQIKHYIYENGVDPEGTFDIPDNLTKGQVI
Download sequence
Identical sequences B6K1W7
XP_002173441.1.46972 SJAG_02230T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]