SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_02464T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_02464T0
Domain Number 1 Region: 213-603
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.73e-84
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.01
Further Details:      
 
Domain Number 2 Region: 634-868
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.81e-44
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SJAG_02464T0
Sequence length 1016
Comment | SJAG_02464 | Schizosaccharomyces japonicus yFS275 2-oxoglutarate dehydrogenase E1 (1017 aa)
Sequence
MSQFTRLSMFSQCHKHLAQPAIRKAVARSTHPAARVVRSYATAPVENDQFLSGATANYVD
QMYDAWKRDPTSVHVSWQAYFKNMENGSVPAAQAFQPPPSIATMHDINAINAALSPKVNG
SAESSSSYIADHLKVQLLVRAYQSRGHLMARLDPLGINIPKTRPSELTLEHYGFSKKDLE
REFTLGPGILPRFCRNGRDTLKLKDIIHECERIYCGSFALEYIHIASREKCNWLRERVEI
PSPYSYTVEEKKMIFDRLTWSDSFERFLAQKFPNDKRFGLEGCEALVPGMKALIDRSVDQ
GISNIVIGMPHRGRLNVLHNVVRKPAQAIFSEFRGTQDPEDEGSGDVKYHLGMNYERPTP
SGKRVNLSLVANPSHLEAEDPVVMGKVRALQHYTSDEASHEQSMGVLLHGDAAFAAQGVV
YETLGLNALPGYSTGGTIHIIVNNQIGFTTDPRFARSTPYCTDIAKTIGAPIFHVNGDDT
EAVTFVCQLAADWRKTFKSDCIIDIICYRRHGHNETDQPLFTQPRMYKTIAKHPSTYKIY
SEQLVEEKTLSKQDIEAHQKKVWDILQQSFESSKDYKVDHTEWLSNPWFGFASPKDLMTK
ILPSYPTGVSVDTLKRVGRSLYTLPEGFDVHRNLRRILNNRLKSVENGKEIDMPTAEALA
FATLLEEGHHVRVSGQDVERGTFSQRHDVLHDQTNESIYIPLNYISPRQASFVIRNSSLS
EFGVLGFEYGYSLSSPNALVVWEAQFGDFANNAQCIIDQFIAAGETKWLQRSGIVLSLPH
GYDGQGPEHSSARIERYLQLCNEDPREFPSEEKLQRQHQDCNLQAIYVTKPHQYFHALRR
NIHRQFRKPLIVFFSKALLRHPLARSTLEDFDENRAFSLILEETEHGKSIKAPEEIKRLV
VCSGQVWVSLLKAREDAKIDDIAFTRIEQLHPFGWKQFAENLQKYPNLQEIVWCQEEPLN
AGAWSFMEPRILTTLRHLGRDIPLRYAGRPPSASVATGNKQQHLAELEQFLNAALK
Download sequence
Identical sequences B6K2J3
XP_002173667.1.46972 SJAG_02464T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]