SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_03743T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_03743T0
Domain Number 1 Region: 7-180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.39e-44
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000131
Further Details:      
 
Domain Number 2 Region: 369-563
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.9e-43
Family Pyruvate oxidase and decarboxylase PP module 0.00000347
Further Details:      
 
Domain Number 3 Region: 172-347
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3e-35
Family Pyruvate oxidase and decarboxylase, middle domain 0.00000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SJAG_03743T0
Sequence length 571
Comment | SJAG_03743 | Schizosaccharomyces japonicus yFS275 pyruvate decarboxylase (572 aa)
Sequence
MSGKGEILVGEYLFQRLLELGVKSILGVPGDFNLALLDLIEKIGDDSFRWVGNTNELNGA
YAADGYARVKGISAIVTTFGVGELSAINGLAGAYAEHVPVVHIVGMPSTKSQASGALLHH
TLGNGDFTVFMEMSEKVSAYTVMLTDGETAADKIDKALSISYRKARPVYIGIPSDVGYFK
TSSAGLKKPLQLEEPANDPKIEEEVVHTIVQMINASKKPVILADACVTRHRVIKELHELI
NLTHFPTYVTPMGKSSVDEVSEWFDGVYVGSISDPAVKDRIESSDLILSVGGLKSDFNTG
SFSYHISQKNTIEFHSDHTKIRYALYPGISMKYLLRRVISSLDAKAMRAKAAKAIGFHVK
PVHAEGFPKDSITHQWFWPKFSEFLIPRDVVVTETGTANFGVLDVRFPHNVTAISQVLWG
SIGYSVGAAFGAALGVYDSAEPDRRTILVVGDGSLQLTLTEISTFIRQGLKPIIFILNNN
GYTIERLIHGLHAVYNEINTKWGYQELLKFFGADQSRTYKVQTPSDVEKLFKDKQFASAD
VIQLVEVVMPTFDAPRILVEQAKLTAKINKQ
Download sequence
Identical sequences B6K2U3
XP_002174876.1.46972 SJAG_03743T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]