SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_03934T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_03934T0
Domain Number 1 Region: 5-329
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.58e-106
Family TK-like PP module 0.00000000541
Further Details:      
 
Domain Number 2 Region: 341-536
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.05e-64
Family TK-like Pyr module 0.000000138
Further Details:      
 
Domain Number 3 Region: 540-673
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.19e-42
Family Transketolase C-terminal domain-like 0.0000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SJAG_03934T0
Sequence length 684
Comment | SJAG_03934 | Schizosaccharomyces japonicus yFS275 transketolase (685 aa)
Sequence
MVSTYTDLDTKAVNTIRTLAVDTTCKSKSGHPGAPMGMAPAAHVLFSRIMNFNPQKPRWI
NRDRFVLSNGHACVLQYALCHLLGYNLTIDDLKNFRQLGSKTPGHPENHNPDLCIEVCTG
PLGQGITNAVGLAIAQAHTAATYNKPGYDLINNRTFCFLGDGCLQEGVSSEASSLAGHLK
LGNLVAVWDNNKITIDGSTDVSFDEDVEKRYEAYGWQVLRVADGDSDYASIEQALLDAVA
CKDKPTLINMKTTIGYGSMKQGTHSVHGSPLSAEDAAHVKREFGFNPEQSFYVAPEVYDL
YKKHVARGVEAQQKFDELFAKYKTEYPELAAQFERVVEKKLPEGWEKKLPTYKPTDPAIA
SRKLSEIVLDSIAPVLPELVGGSADLTGSNLTRWKGAVDFQPKESNLGDYSGRYIRYGVR
EHAMGGIMNGMAAYGTVIPFGGTFLNFVSYAAGAVRLAALGQFRTIYVATHDSIGLGEDG
PTHQPIETYAHFRAMPNINCWRPADGNETSAAYHSAISLAQTPSILALTRQNLPQLNGSS
IEKALKGGYVLVENKDANVTLIGTGSEVSLCVEAAKVLEAEHGLKARIVSMPCCEIFDEQ
AQEYRLSVLPDGIPIMSVEVYSTVGWKRYAHEAFGIDSFGDSAPYQQLYAKYEMTPEGVA
VRAKMTVDAWKPVQNIRSPIHHAF
Download sequence
Identical sequences B6K5F9
XP_002175056.1.46972 SJAG_03934T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]