SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_04842T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_04842T0
Domain Number 1 Region: 368-562
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.02e-43
Family Pyruvate oxidase and decarboxylase PP module 0.00000557
Further Details:      
 
Domain Number 2 Region: 6-181
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.21e-38
Family Pyruvate oxidase and decarboxylase Pyr module 0.000002
Further Details:      
 
Domain Number 3 Region: 172-344
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.45e-33
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SJAG_04842T0
Sequence length 571
Comment | SJAG_04842 | Schizosaccharomyces japonicus yFS275 pyruvate decarboxylase (572 aa)
Sequence
MSSEKILVGEYLFQRLLQLGIKSILGVPGDFNLALLDLIDKVGDETFRWVGNANELNGAY
AADGYARVKGISAIITTFGVGELSALNGIAGCMSERIPVVHIVGVPSTKNQAVKPLLHHT
LGDGDFKVFERMSAEISAEVQFLDSAETAPQKIDHILETCWREKKPVYLAIPSDSGYFSC
DASGLKTPLNLSYPENCPVAEAEALKEIVSRINSAKKTAILVDACVSRFDAKEETQALVD
ATHFPTYVTPMGKTAINESSPYFDGVYVGSLTETDVKERLESADLLLNVGALRSDFNTGT
FTYGTPVTNTIELHSTWTQIGTAKYENVGMKALLPKIIAALDLKAVQAKAAPVNFKVPTP
TAAEGYPAGTITQKWFWPTLSTFLKDSDVVVTETGTSNFGSLDCRMPKNATHLSQVLWGA
IGWSVGALFGACLAVKDSDKPDRRTVLIVGDGSLALTVQEISTCIRQGLKPIIFVINNNG
YTIERLIHGLHAVYNDINTEWNYQNLLKDYGAKDSRSYNIHTEKELVELFQNKEFAAADV
IQLVEVHMPLLDAPRVLVEQAKLTAAINKRV
Download sequence
Identical sequences B6K7W8
XP_002175915.1.46972 SJAG_04842T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]