SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_05027T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_05027T0
Domain Number 1 Region: 385-738
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.41e-54
Family PFOR PP module 0.00012
Further Details:      
 
Domain Number 2 Region: 1012-1211
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000316
Further Details:      
 
Domain Number 3 Region: 710-866
Classification Level Classification E-value
Superfamily Flavoproteins 1.79e-36
Family Cytochrome p450 reductase N-terminal domain-like 0.0086
Further Details:      
 
Domain Number 4 Region: 1308-1439
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.9e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000223
Further Details:      
 
Domain Number 5 Region: 880-1010
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.64e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.0046
Further Details:      
 
Domain Number 6 Region: 242-360
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000628
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.004
Further Details:      
 
Domain Number 7 Region: 1223-1304
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.000000000000121
Family Duplicated SiR/NiR-like domains 1 and 3 0.0029
Further Details:      
 
Weak hits

Sequence:  SJAG_05027T0
Domain Number - Region: 99-193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0388
Family PFOR Pyr module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SJAG_05027T0
Sequence length 1461
Comment | SJAG_05027 | Schizosaccharomyces japonicus yFS275 sulfite reductase beta subunit (1462 aa)
Sequence
MGITTKLTSAQEAVARIAYRSADFLYVIESTKTALTADSLKAVRNLQENETLNASGYRPI
VQNLKAHADPFIYVADASSHPITAERPHLDAVVAASDSLFFATPHLYTLANTPVVVHIAL
GSTETFDFAAVRDTGFLILFSGNNAADASASIADTIRTAAQAHKLALKLNTGVLHFYTPV
SKGAYALEDVALLPTKDEMDWARDAFGESFKIRGSTPIQTTSQRSAKIQSAVAAIKELGI
SPFDFNGPADASTVLLSFGSSAGLLNSAATDSKLATLSVRVLRPWLFDELIQVLPESVKR
LVVLEQVSALPKKWEQLYLDVLVELKSRNSAIELLSAQYALSAETDAVKLIASLLQELKK
PIPSASDLRFVYGSVKEESLVPTPPLIEETYHKLLQRVFKARLRVANDSSLASAKSIPAQ
LVISPQFALGSVLEYEKNREHFCSRIGKLLKGGAITNNETLEALSNWLVSVNNEDSTLDP
TLVIEALKKDSAPSVQELLSESHYFVKKSHWIIGSDAWAYDLGNSAVHQALCDEANVNLL
VIDTQPYSTRNDVLQRKKDIGLYAMNFGNAYVASVAIYSSYTQVLAALLEADKFKGPSVV
LGYLPYFTSEDDAITVMKETKCAVDAGYWPLYRWTPALKDGEYSDFQLDSERVRDELKKF
LDRDNYLTQLTLREPRLAKTLTESFGAKVREQQKLDARAALNRLLEGLSGPQLTILYASD
GGVSEGVAKRLNGRATARGSKSKVMAMDDFPLSELEKEENVVFLVSTAGQGEFPQNGREF
WKELKGNVDLSLSKLNFAVFGFGDYDYWPRKEDKIYYNRPSKQLDARLAELGAHPLISLG
LGNDQDPDGWATAYNVWEPELWASLGLDNVDVDINEPAPVTAEDIKRTSNYLRGTIMEGL
ADTTTGAVSESDSVLVKFHGMYMQDDRDIRDERKKQGLEPAYTFMLRLRMPGGVCSAEQY
IALDDISTKWGNKTLKITTRQTFQSHGVLKGNLRSSIRAIVKVMLTTLGASGDVCRNVTA
ACIPTNTKLHKQIYDVAKEASEGLLPSTSAYHEIWIEDPETVEKRKVAGEAVQDVEPLYG
PTYLPRKFKVGIAVPPHNDIDVYINDVGLVAITSEDGDILEGFNVYIGGGLGTTHNNKKT
YPRLGDLAGYVPVAKTLDILKAILIVQRDNGDRENRKHARIKYTVDTMTFEKFVAETERN
AGFKFEPARPQQPFVDNTDDFGGWAKTDLGTYSRTIFIENGRIEDTAQLQFKTGMRELAE
KLLDTGSKAEFRMTANQHMILHNVSESELPWVNAHLAKYKLDNTAFTGLRLSSAACVALP
TCGYAMAESERYLPKLITKVEDIINEAGLTKDSITMRMTGCGNGCSRPWVAEIACVGKAP
NTYNLLLGGGHSGERLNKLYKASVQEKEILDLLRPIIKRYALERQDNEPFGDFVIRTGYV
TATERNGANGAVHEGISADAA
Download sequence
Identical sequences B6K8E8
XP_002176095.1.46972 SJAG_05027T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]