SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_02734T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_02734T0
Domain Number 1 Region: 368-562
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.43e-43
Family Pyruvate oxidase and decarboxylase PP module 0.00000557
Further Details:      
 
Domain Number 2 Region: 6-181
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.19e-38
Family Pyruvate oxidase and decarboxylase Pyr module 0.000002
Further Details:      
 
Domain Number 3 Region: 172-344
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 6e-33
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SJAG_02734T0
Sequence length 571
Comment | SJAG_02734 | Schizosaccharomyces japonicus yFS275 pyruvate decarboxylase (572 aa)
Sequence
MSSEQILVGEYLFQRLLQMGIKSILGVPGDFNLALLDLIDKVGDETFRWVGNANELNGAY
AADGYARVKGISAIITTFGVGELSALNGIAGCMSERIPVVHIVGVPSTKNQAVKPLLHHT
LGDGDFKVFERMSAEISAEVQFLDSAETAPQKIDHILETCWREKKPVYLAIPSDSGYFSC
DASGLKTPLNLSYPENCPVAEAEALKEIVSRINSAKKTAILVDACVSRFDAKEETQALID
ATHFPTYVTPMGKTAINESSPYFDGVYVGSLTEPDVKERLESADLLLNVGALRSDFNTGT
FTYGTPVTNTIELHSTWTQVGTAKYEKVGMKALLPKIIAALDLKAVQAKAAPVNFKVPTP
TAAEGYPAGTITQKWFWPTLSTFLKDSDVVVTETGTSNFGSLDCRMPKNATHLSQVLWGA
IGWSVGALFGACLAVKDSDKPDRRTVLIVGDGSLALTVQEISTCIRQGLKPIIFVINNNG
YTIERLIHGLHAVYNDINTEWNYQNLLKDYGAKDSRSYNIHTETELVELFQNKEFAAADV
IQLVEVHMPLLDAPRVLVEQAKLTAAINKRV
Download sequence
Identical sequences B6K115
SJAG_02734T0 XP_002173929.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]