SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_03064T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_03064T0
Domain Number 1 Region: 35-218
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.03e-62
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000284
Further Details:      
 
Domain Number 2 Region: 225-361
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.7e-37
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SJAG_03064T0
Sequence length 364
Comment | SJAG_03064 | Schizosaccharomyces japonicus yFS275 pyruvate dehydrogenase E1 component subunit beta (365 aa)
Sequence
MLRTVRFGTFFRGGARPTFGARSVTKRFASTGVKELTVRDALNGAMEEEMKRDEKVFLLG
EEVAQYNGAYKVSRGLLDKFGPKRVIDSPITEMGFAGLCTGAAFAGLRPICEFMTFNFSM
QAIDHIINSAARTLYMSGGIQNCPIVFRGPNGPAAAVAAQHSHHFGPWYGSVPGLKVLSP
YSAEDARGMIKAAVRDPNPVVILENEILYGQTFPVSEEAQSEDFVIPFGVAKIERPGKDI
TLVGESISVGTSLQAADILKSKYGVEAEVINLRSIRPLDIDTIAASVKKTNRLVTVDQAY
SSFGIGSEICAQIVESSAFDYLDAPVERVTMADVPMPYNQSLENMSLPNADVVVAAAKKA
LYIN
Download sequence
Identical sequences B6K381
SJAG_03064T0 XP_002174231.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]