SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SJAG_03985T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_03985T0
Domain Number 1 Region: 464-665
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.75e-64
Family Pyruvate oxidase and decarboxylase PP module 0.00000054
Further Details:      
 
Domain Number 2 Region: 87-264
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.47e-60
Family Pyruvate oxidase and decarboxylase Pyr module 0.000000159
Further Details:      
 
Domain Number 3 Region: 284-458
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.36e-58
Family Pyruvate oxidase and decarboxylase, middle domain 0.00000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SJAG_03985T0
Sequence length 670
Comment | SJAG_03985 | Schizosaccharomyces japonicus yFS275 acetolactate synthase (671 aa)
Sequence
MASPALLRRVPRARFGAICSGQLLSASGRTLNARLLLSRTITNSTKLSSATTSASIASTG
VRATTPDVLGDFQKVGANTRYDNTYVGKTGGEIFHDMMLKHNVKNVFGYPGGAILPVFDA
IYKSPYFDFVLPRHEQGAGHAAQAYARATGKPGVVLVTSGPGATNVITPIADAMADGTPL
VVFCGQVATAAIGTDAFQEADMVGISRPCTKWNVMVKDVADLPRRIDEAFEIATSGRPGP
VLVDLPKDVTASVLKNPIPVVSSMPTFTRKIKETLEERSKIIDSKLDRVQTLLSRAKKPV
IFAGHGILSNPDGPKVLRELSEKLSIPVTTTLLGLGAFDERSDLSLHMIGMHGSGYANMA
VQEADCLLALGARFDDRVTGNTKLYAPEARLAGQEERGGIIHFDISPKNIGKVIRPTEAI
EGDVTEMLKLLLPRLTAVSRLQREEWLSQIASWKKRFPFTFTPSKPGELLKPQAVIQELD
RQTAEIKDKVVITTGVGAHQMWAATFYRWTQPRSLITSGGLGTMGFGLPAAIGASVARPD
SIVIDIDGDASFSMTGMEMATVRQFNLPVKILLLNNEEQGMVTQWQNLFYQKRYSHTQQV
NPDFPKLAEAMGLKGLRVTKQEELAPTMKQFLETEGPVLMEVKVASKEHVYPFVPAGKAL
HQFILHGSLS
Download sequence
Identical sequences B6K5L0
SJAG_03985T0 XP_002175107.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]