SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|399543458|ref|YP_006556766.1| from Marinobacter sp. BSs20148

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399543458|ref|YP_006556766.1|
Domain Number 1 Region: 9-314
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 3.27e-91
Family Acetamidase/Formamidase-like 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|399543458|ref|YP_006556766.1|
Sequence length 315
Comment acetamidase / formamidase [Marinobacter sp. BSs20148]
Sequence
MCQQTLVKTIHGGHHHHGWDNSFAPVARVAPGSMVELECKDSGNGHFTTDSTVAAVSSMP
FDKINPVTGPIYVEGAEPGDILKVTIDSFRPSGFGWTANIPGFGLLTDQFQNPALMLWHY
DRNNMTPAAFGKFAKVPLKPFAGTIGLALAEPGLHSVVPPRRVGGNLDIRDLNAGSSLYL
PVEVAGALLSIGDTHAAQGDGEVCGTAIESAMDVTVKLDLIKDTPLAMPRFTTAGPVTRH
LDGSGYEAFTGIGPDLMQAARDAVSGAIDWITREHHMPPEQAYMLCSVCGDLRISEIVDM
PNWVVAFYVPRLVFE
Download sequence
Identical sequences M1FG77
WP_014869732.1.23067 gi|399543458|ref|YP_006556766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]