SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|399544514|ref|YP_006557822.1| from Marinobacter sp. BSs20148

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399544514|ref|YP_006557822.1|
Domain Number 1 Region: 120-283
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00047
Further Details:      
 
Domain Number 2 Region: 411-552
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.37e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0006
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.6e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.045
Further Details:      
 
Domain Number 4 Region: 252-276,318-424
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|399544514|ref|YP_006557822.1|
Sequence length 555
Comment sulfite reductase [ferredoxin] 2 [Marinobacter sp. BSs20148]
Sequence
MYQYNQIDQTLVDERVEQFRDQTRRFLNGELPEDEFSALRLMNGLYIQRQAPMLRVAVPY
GLLSSTQMRKLAHVARTYDRGYGHFTTRTNIQFNWPELAAVPDILAELAQVQMHAIQTSG
NCIRNTTTDPYAGVAENELEDPRPYCEIIRQWSTLHPEFAYLPRKFKIAVTGATEDRAAS
QVHDIGLQMVQNADGEIGFEVLVGGGLGRTPIIGKSIRKFLPKQHLLSYLDAILRVYNLK
GRRDNKYKARIKILVEALGPDEFRRLVEEEWAHIRDGELTLTDAEIARAKSFFTLPDYDV
NAASADAHASLNDSLATDIEFNAWYRHNTLAHRVEGYRIAIVSLKPYLEAPGDITDSQMD
AVADLADRYSFGETRATHHQNLVLTDVREGDLYAVWQALATNNLARSNIGTLTDMIVCPG
FDFCSLANARTLNISDQINEHFDDMDHLYDLGEIRLNMSGCINACAHHHVADIGILGVDK
KGEDWYQISLGGSSKEDARLGKILGRSVPASDVALTVEKILAVYVDQRRENESFAQVVLR
VGIKPFKERVYATAH
Download sequence
Identical sequences M1FEG9
WP_014870766.1.23067 gi|399544514|ref|YP_006557822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]