SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCAG_07260T0 from Histoplasma capsulatum class NAmI strain WU24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCAG_07260T0
Domain Number 1 Region: 549-860
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.96e-67
Family Glutamine synthetase catalytic domain 0.00031
Further Details:      
 
Domain Number 2 Region: 184-410
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.04e-28
Family TatD Mg-dependent DNase-like 0.019
Further Details:      
 
Weak hits

Sequence:  HCAG_07260T0
Domain Number - Region: 445-542
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0051
Family Glutamine synthetase, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HCAG_07260T0
Sequence length 862
Comment | HCAG_07260 | Histoplasma capsulatum NAm1 extracellular developmental signal biosynthesis protein FluG (863 aa)
Sequence
MADEAALRHLIFDHPIIDNHAHNILKADRASNYDRYPFETITSEAQGESLGSHAANSLAL
IRAVNQLAELFGCAPELNAIKSAREKEIENDYDGLVKKCLTGTHMLLIDDGVPEGDMELY
SWHDQFTNAASKRIVRIEAVAANIIEKLLEIRTISRKSLLLEELKSTKDFWNAFRDSFSA
AIKNALDDPAVVGFKSVVCYRTGLKIWKGSAEALFASFETYFRHFVETGESRIQNKPLND
YLVISVLEHISQQSKESRKPIQFHTGLGDSDINLLRSNPAHLQNLIEEYPNVDFVLLHSS
YPYTREAGYLASIYANAYLDVGEVFPMTSRDAQLSILRQSLELVPSTKLLWSTDGHYHPE
TFWLANKQFRQALYTIFTEYVYHGDYTYGQAMEAVRDILFFNSNRLYNLKQSPDSPDFDL
NYLQTRGLSPAVFQTATTSTPEDILKKFLHKKSVDFIWMQWVDYTATVRVRMFPIRQFKK
IVSSKHKVGICLAVMIMLQNDTLASPEPLSTGEFILTPDVTTLCRNIGLSSRSATVMTFW
KNQDGGELEGCPRTILQNTVNKCQKVVFMKISKEGSSTSYSPWFTNHSWSNITTENVQAL
PMIEKIVDKLADIDIHLQQFHTESGPSQFEFILPPSTPLAACDTLIQARQTITDVATQYG
VRATLHPRPIPNAAGTASHTHLSITPTTFKDNFLAGLLQNLPSISPFTLPQDASYERIAE
GIWSGGVWVAWGYQNRETPIREVSSGHWEFKPMDGLANPYLAVAAIIGSGYLGIKNRMPL
TIKGCNVNTAALSPSQRAALSITTRIPSSLEESLKALESNVELQTLLGPGFFRRYVCVRR
GEQKMLNAMDKEQRRNWLIERY
Download sequence
Identical sequences HCAG_07260T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]