SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCAG_00946T0 from Histoplasma capsulatum class NAmI strain WU24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCAG_00946T0
Domain Number 1 Region: 39-117,175-254
Classification Level Classification E-value
Superfamily CBS-domain pair 2.93e-28
Family CBS-domain pair 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HCAG_00946T0
Sequence length 368
Comment | HCAG_00946 | Histoplasma capsulatum NAm1 CLC voltage-gated chloride channel (369 aa)
Sequence
MFEITGSNNLYPPNHVSNSFGKGGIADRMIWFNGFPFLDSKEDHIFNVPVSHAMTNKPAV
LPATDFPVSKAEKLLRQHKYKGFPIVEDAINKVVIGFIGRTELQYAINRAKQEGLLSPNA
KCRFTTTPSFTSYRQRGSIPSSNSVTLPVPSPNLQTFGSKPSSSSRSEDSPYNSDFSHDD
QAPSRTFDDIAISTGFRSIDFSPYVDPAPITVHPRLPLETVMEIFKKMGPRVILVEHRGR
LSGLVTVKDCLKYQFKVEAQEHIDGSGDDGHSHSQGHGGNGGLGEGIVEKKAWEFIQWAT
NKVAFWRRMGETGMPSFLRLGSSEGDGEWHARRRGGEHERSEWDGQLLSSITSSGIVEGT
EELDERND
Download sequence
Identical sequences HCAG_00946T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]