SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCAG_03899T0 from Histoplasma capsulatum class NAmI strain WU24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCAG_03899T0
Domain Number 1 Region: 170-214,253-673
Classification Level Classification E-value
Superfamily Clc chloride channel 1.01e-105
Family Clc chloride channel 0.00015
Further Details:      
 
Domain Number 2 Region: 675-828
Classification Level Classification E-value
Superfamily CBS-domain pair 4.72e-26
Family CBS-domain pair 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HCAG_03899T0
Sequence length 878
Comment | HCAG_03899 | Histoplasma capsulatum NAm1 chloride channel protein (879 aa)
Sequence
MTGIASGLNAAHIPVNHDSSQASRSCGDPTSEQDDLASTHSGDETVLATDPLGDAFDEPI
SFKRKQKGPARFALSNFFSSTEGTSHPPLHNPFGNNSGASTNRTPSPAAATTGNGGLEGN
KAGGPLDWYVEGPGRRVGYDNLTAIDWIFEYTKERQRIRHLYASNKGLFGYVRKILDASH
IWIILILTGIAVGVIAACIDIASSWLGDIKTGYCRTGVEGGKFYLNKSFCCWGYDDLSEC
QHWTPWRNALHVGSKTVGYAVEYVFFIMYSILFATTASVLVRKFAVHAKHSGIPEIKTVL
GGFVIKRFMGAWTLLIKSLGLCLSAASGLWLGKEGPLVHVACCCASLIMRPFPSLNRNEA
RKREVLSAASAAGISVAFGSPIGGQLSYYFPDKTMWQSFVCAMVAAVTLHALNPFRTGKI
VLYQVTYSRGWHQFELLPFALLGIVGGLYGGLFIKLNMRVARWREARSYSHPILQVALVA
LISALINFPNTFMRAQLSDLVYYLFAECAEVTDDQFGLCKTGSASLGVIGLLLLAAILGF
FLASITFGLDLPAGIILPSLAMGALSGRALGIAFEMWQKAQPDLLLFRKCEADIPCITPG
TYAIVGAASALGGATRMTVSIVVIMFELTGALTYVIPIMISVMLSKWCGDTFGKRGIYES
WIHLRGYPFIEQKDEVVLPDIPVSQVMTSIHDLSVITAVGHTIDSLLHLLDKTSYRGFPV
VSDTSNPILLGYISRNELSFALKSATSRSSRGVSPETPAYFAHQPFADPLEILDLRPWMD
QTPITLNSRASFLVVLTMFQRLGLRYVLFVNKGALQGFLTKKDVWYIIEDAQKRRAEGLR
DNEIGEGNTEDEGRFRRNDDNDHHNISTFSPLDARHSL
Download sequence
Identical sequences HCAG_03899T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]