SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCAG_05866T0 from Histoplasma capsulatum class NAmI strain WU24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCAG_05866T0
Domain Number 1 Region: 239-377
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000301
Family CBS-domain pair 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HCAG_05866T0
Sequence length 735
Comment | HCAG_05866 | Histoplasma capsulatum NAm1 DUF21 domain-containing protein (736 aa)
Sequence
MYPNQHVAGRSLALAVGKLLFLAIAQFPTTYAFPILGSLQLRDQEHGNPSDDPRLWLYLS
VAAALVISGGAFAGLTIALMGQDEVYLQVIKTSGEGAEKKHAEKVLNLLKRGKHWVLVTL
LLSNVITNETLPIILDRSLGGGWPAVLGSTALIVIFGEVVPQSICVRYGLPIGAWMAPCV
LVLMYIMSPVAWPIAKLLDRILGEDHGTIYKKAGLKTLVTLHKNLGQAGEQLNSDEVTII
TAVLDLKEKSVGSIMIPMEDVFTMSADTVLDEKMMDLILSQGYSRIPIHSPDEPHNFVGM
LLVKMLITYDPEDCKLVRDFALATLPETRAETSCLDIVNFFQEGKSHMVLVSEYPGEDHG
ALGVVTLEDVIEELIGEEIIDESDVFVDVHKAIRRMAPAPKSRVPKGQIVSEPTPTHGSL
IDVSDNNVTNQEPTRSETLARSHSVADYGSPPQTTFYFRKHNTFDSTDSVDSPITMRGPT
PEIREHLKHLGPSNLASRPRQTRYQTVKIKPGEVTSSDRQSSVSQSRPSEHLSAVPTRPQ
SQVRSAGKSASDAVLAVQTYGTMGRTTQSPTAEMMEEISTHRGSPRHDRSRNLTTSKNEA
SVVSRSPSTRSHRNRPSSAGSGAQKTREPHRRHGPARSGSITEQIVDSNGIRKVILQTSS
DATTDEDGGVGTSPGADQAQTTQALTSSSGNATPPANGSSGTHGEKKKRRRKRRWGAGTK
STDQGNRDETQHLLE
Download sequence
Identical sequences HCAG_05866T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]