SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCAG_07028T0 from Histoplasma capsulatum class NAmI strain WU24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCAG_07028T0
Domain Number 1 Region: 96-197
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 5.3e-26
Family Glutamine synthetase catalytic domain 0.04
Further Details:      
 
Domain Number 2 Region: 6-93
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 2.49e-21
Family Glutamine synthetase, N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HCAG_07028T0
Sequence length 210
Comment | HCAG_07028 | Histoplasma capsulatum NAm1 glutamine synthetase, partial (211 aa)
Sequence
MKYMSLDQRGHVLAEYVWIDGSGGVRSKTKTLKGSVKSVEELPEWNFDGSSTGQAPGENS
DVYLRPVAMYADPFRRGDNILVLCETWDSDGSPNKFNYRHEAAKLMRTHANEHFWFGLEQ
EYTLLGPDGWPYGWPKGGFPGAQGPYYCGVGTGKVHCRDIVEAHYKACLYAGINISGVNA
EVMPAQWEFQVGPCEGINRELSHRTLSTHV
Download sequence
Identical sequences A6RBM0
XP_001537606.1.38663 HCAG_07028T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]