SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347522823|ref|YP_004780393.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|347522823|ref|YP_004780393.1|
Domain Number - Region: 222-319
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0371
Family MJ1460-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347522823|ref|YP_004780393.1|
Sequence length 334
Comment hypothetical protein Pyrfu_0269 [Pyrolobus fumarii 1A]
Sequence
MLTVSKAISEHDNLAMVKPLVSEEEIYLDIEAMIKLMAITVRGLELAVGQRSAMALGTIM
GSQLYKSMSPSIKGKNLKEALEAVNTRSFRIDVYKMRGKVVHEDPQTGRKVFYYVGRECP
IRQILYHEDIPAGGTLCRIMCSFVEQLLADVLGGKYSVKLLRYGPNACFLRVEIVNGPQP
PDDVAVYSKKPSLEEYVMLLREDLRSILVAFDATVDRVLGGNPTMSYMAGKRYGLLDGDN
LLSTIGRTISVDEAITVLNVAYKGLLELSKEGDVISLERSVFHDLVEKLQLGRAVFIYRT
LQGYLAGLLERLTGHRVDLRGLDEKATQLKILMR
Download sequence
Identical sequences G0EF98
gi|347522823|ref|YP_004780393.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]