SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347522896|ref|YP_004780466.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|347522896|ref|YP_004780466.1|
Domain Number - Region: 56-139
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00523
Family Transglutaminase, two C-terminal domains 0.016
Further Details:      
 
Domain Number - Region: 7-47
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0327
Family Multidrug resistance efflux transporter EmrE 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347522896|ref|YP_004780466.1|
Sequence length 150
Comment hypothetical protein Pyrfu_0342 [Pyrolobus fumarii 1A]
Sequence
MVAGRVRAVSPVVAAMILILVAVVGGLMVWMFMGQFMRPRTIASLSVSGVTAVIPPDGSE
LSINLMVKNDGNVPLNVTVVEFGYEGATYNVTLNRLLSAGATTTLGFTLKPGDFGATSFV
EGKTLRVTVYYRDPQGNEYSKTTYATIQIG
Download sequence
Identical sequences G0EFP3
gi|347522896|ref|YP_004780466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]