SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523290|ref|YP_004780860.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|347523290|ref|YP_004780860.1|
Domain Number - Region: 4-40
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0114
Family Transcriptional factor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347523290|ref|YP_004780860.1|
Sequence length 57
Comment hypothetical protein Pyrfu_0739 [Pyrolobus fumarii 1A]
Sequence
MAKKAVCPICGGDVELPDNVMDGEIVEHDCGAMLVVRIRDGNVVLEQLERVEEDWGE
Download sequence
Identical sequences G0EDC3
WP_014026285.1.63292 gi|347523290|ref|YP_004780860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]