SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347523499|ref|YP_004781069.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523499|ref|YP_004781069.1|
Domain Number 1 Region: 4-237
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 1.96e-70
Family Purine and uridine phosphorylases 0.000000827
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347523499|ref|YP_004781069.1|
Sequence length 241
Comment purine or other phosphorylase family 1 [Pyrolobus fumarii 1A]
Sequence
MKPQHLTAKPGEVAERVVVVGDPARAKMVAEEFLEDARVVSENRALYVYTGSYKGVPVSV
AVHGIGGPSAAIVFEELRMLGAKAMVRLGTAGGLKPEIDVGHAVVVTGAAYYCGGTLGVY
TPNACMPTAPDPTLTVKLYEAAKREGLTVHMGPVISNDAFYAESPDFAEFWAKRGIIAVE
MECATLFGIGWMRGFRTAALVVIADNLVVPEKKDLLHHEQLAPIMRKAAKAVLEALVETN
V
Download sequence
Identical sequences G0EEC3
WP_014026494.1.63292 gi|347523499|ref|YP_004781069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]