SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347523527|ref|YP_004781097.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523527|ref|YP_004781097.1|
Domain Number 1 Region: 258-612
Classification Level Classification E-value
Superfamily SIS domain 8.72e-99
Family double-SIS domain 0.00000309
Further Details:      
 
Domain Number 2 Region: 2-241
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.63e-62
Family Class II glutamine amidotransferases 0.00000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347523527|ref|YP_004781097.1|
Sequence length 612
Comment glucosamine/fructose-6-phosphate aminotransferase [Pyrolobus fumarii 1A]
Sequence
MCGIIGVTVSPQCQQRNAVPLLLEGLKRLEYRGYDSAGVALIMCSNSSCDVKVYKAKGKV
DEVIERFSLREKYSLTCLGHTRWATHGPPSDTNAHPHVDCRGYIAVVHNGIIKNYAMLKQ
VLSEHGHRFRSETDTEVVAHLLEEFLREGLGMLEAMRKLLEVLEGSFALAVLYSGTPNRV
YFARRESPLYAAVGDCISAVSSDIPSLLHISRLVVPIEDDEYGYVEPGHLSLYDRRGEPV
DWRRRAKIVTWSIEEASKGGYPHYMLKEIFEQPRALYETLIGLIEDPALEEAAELLVNAR
RVFVTGAGTSYHATLVFKHYITGMAGIVPIDFIASEHPEYMAAVSHEDVLIAVSQSGETT
DTLQAVREAKKRGVKIIAVTNVIGSTLSRLADVTLYTRAGPEIGVAATKTFLTQVLTLQL
LAARVACKLGVIDKSDFESIVEKLSSAREAARSAERLNPHIKALAVILSKAQSMFVLGRL
LGAHLAREAALKIKEISYVHAEAYPAGESKHGPIALVEEGFPVIFVGTPGVEKKLYSNME
EMKARGAKVIVVGVDSYEDAPADYKVLVGSYDETLAPYAIMPPLQLLAYHMAVMLGYDPD
KPRNLAKTVTVE
Download sequence
Identical sequences G0EEM3
gi|347523527|ref|YP_004781097.1| WP_014026522.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]