SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347523549|ref|YP_004781119.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523549|ref|YP_004781119.1|
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Folate-binding domain 3.77e-76
Family Aminomethyltransferase folate-binding domain 0.00000678
Further Details:      
 
Domain Number 2 Region: 280-367
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 8.34e-17
Family Aminomethyltransferase beta-barrel domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347523549|ref|YP_004781119.1|
Sequence length 372
Comment glycine cleavage system T protein [Pyrolobus fumarii 1A]
Sequence
MPLRSPLYQLHRELGAVFTVFAGWEHPVDYGSVVEEHLAVRKRVGVFDLSHLGRIIISGS
DAKELLEKLVPRRLAGKPGVVDGPTAFLDEKGGFIDDVLLYPLSNGEWMIVANAASREKD
IAWLQQWARRLGLDVEIRDETFSMALVAVQGPESLRVLGRVGLDVATLESLKRMEFVENL
DSPFGKLRVVSRSGWTGEDGFEIYADPDTSAKLFRALVEAGARPCGLGARDSLRMEVGFP
LIGDELGPDVTPIEARYWLVLDMGKVASGECVGCDAVWRRLLEGVSRVRLGVKLGKGVRL
VPRKGDKILVGDVEIGRVTSGAYSPILERGIGQAYIDAGHALPGLEVVVERGKKRVKAKL
VDFPLIKLGGRG
Download sequence
Identical sequences G0EEP5
gi|347523549|ref|YP_004781119.1| WP_014026544.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]