SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347523829|ref|YP_004781399.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523829|ref|YP_004781399.1|
Domain Number 1 Region: 104-274
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.41e-44
Family NadC C-terminal domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 3-103
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.63e-20
Family NadC N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347523829|ref|YP_004781399.1|
Sequence length 280
Comment modD protein [Pyrolobus fumarii 1A]
Sequence
MPRRLLEEWLFEDVGRGDLTSTVLGLRSVKGVAELYVRESCIVACSEEAGEVYRIAGAEN
VEVLVESGSMVEPGTVVLRAEGRGDALHAAWRVAQVIVALCSGVATKTWRMVRKAREANP
KIAIVTTRKAPPGLRPLYFKAVIAGGGMPHRAGLDDTVLLFDNHWVLLRGGFSEALERLR
ASNVGALRSWGVEVRSVEEALEAIAAGAQFIQFEKVKPDLLRQFVRVVREKAPHVKIGVA
GGIDDHNVAEYAATGVDFIVTSAPYHASPVDVGTRMKRLE
Download sequence
Identical sequences G0EGC2
WP_014026824.1.63292 gi|347523829|ref|YP_004781399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]