SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347523846|ref|YP_004781416.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523846|ref|YP_004781416.1|
Domain Number 1 Region: 27-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000987
Family GHMP Kinase, N-terminal domain 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|347523846|ref|YP_004781416.1|
Domain Number - Region: 246-291
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00959
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347523846|ref|YP_004781416.1|
Sequence length 318
Comment GHMP kinase [Pyrolobus fumarii 1A]
Sequence
MRVRIETGARLHFGFYNLMPVRRLWGSIGLAVDGVGYDIVIEEGGNGIVVEGCQRARFHR
ILLEALERLRLGDMSIKLVARKCIPEHRGLGSTTQAKLAVYAGLARLASLDIDVYKLAEL
AGRGKVSGVGIAAFAYGGFIIDTGRRVGVETGVPKPMMRIELPEKWRIVYLTPMTSWRVA
EEGEVVFQGSIDPTLHCTLLETVFTWLAPAAVEKDFESFTAALEEIERIMGMYFSKAQEG
AYCCRETAAAAEELRRAGGRGVGQSSWGPTVYAFFPDEESARTALNQAASRLEQRGIRLE
YYGVLKPRNRGAVVTLEG
Download sequence
Identical sequences G0EGD9
gi|347523846|ref|YP_004781416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]