SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524050|ref|YP_004781620.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|347524050|ref|YP_004781620.1|
Domain Number - Region: 20-129
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0178
Family FAD-linked reductases, N-terminal domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347524050|ref|YP_004781620.1|
Sequence length 226
Comment hypothetical protein Pyrfu_1511 [Pyrolobus fumarii 1A]
Sequence
MDNGNTKTHPINLPFFTHNTRNILVIGYGILTALVAYILSDLGYATGFSLMGPLAPRVCI
PRGKIAWRYTLRLLPPLTSIRLRLRNKSTCIRETPNLLGYAARRLVAHGIPLIATRYAHR
LAEKNDNYSIIYVAYCPPRYVVDEHIDQVYACRCTKHSDYILVSDPRSAPPGCTCNLLDA
CVTTRHDTVYIEFENEVAVFIPNIENLEPTVEEVMSRWGRPSHGSA
Download sequence
Identical sequences G0EHL5
gi|347524050|ref|YP_004781620.1| WP_014027045.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]