SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524165|ref|YP_004781735.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524165|ref|YP_004781735.1|
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily CBS-domain pair 1.01e-18
Family CBS-domain pair 0.00068
Further Details:      
 
Domain Number 2 Region: 261-333
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.000000000000965
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.0038
Further Details:      
 
Domain Number 3 Region: 138-243
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000259
Family CBS-domain pair 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347524165|ref|YP_004781735.1|
Sequence length 336
Comment CBS domain containing protein [Pyrolobus fumarii 1A]
Sequence
MVPTVANVMEDKRLPIISADQSLRKAAEVMLENRVLGTITLDALRRPELVLSYRRLVRAV
AAGVDIDKATVAEQAVLKPVTVRTTDSITEALNIMRKRGVRFLPVVDETGEVKGVLEPRF
AAYALWSRLSYGLARVEPVSRRIVVLPEDASLRAAAKAMDETGAMEVFVKRGDEITVLRE
WDFLEALIKGGPEAKIGDYAKGEIIYVPPGFDSKAAVELMHENDVTRLIVKKDGELTTIT
LTDLAFQAMDYLAYMGERVKGVVLVNVETGREHEVAERIMAVPGVKEVLMATGPFDLIVL
LEASSTSELFKIVSEGIRSLRAVKSTQTLVATRVLH
Download sequence
Identical sequences G0ECB3
WP_014027160.1.63292 gi|347524165|ref|YP_004781735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]