SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347524285|ref|YP_004781855.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524285|ref|YP_004781855.1|
Domain Number 1 Region: 8-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.72e-59
Family Extended AAA-ATPase domain 0.000000278
Further Details:      
 
Domain Number 2 Region: 228-320
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.23e-21
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347524285|ref|YP_004781855.1|
Sequence length 327
Comment Replication factor C [Pyrolobus fumarii 1A]
Sequence
MASELAELLWAEKYRPKTLDEIVNQEEIVRRLKKFVEEKNMPHLLFVGPPGTGKTTAAHA
LAHDLFGENYRQYMLELNASDERGIETIRTKVKEFARSRTPPGIPFKIVLLDEADNMTAD
AQQALRRLMEMYTASTRFILIANYPSKIIEPIQSRCAIFRFTPLKKEDVVARLKWICEQE
GCQYDEEALETIYEISEGDMRRAINILQAAAALGKVTVEAVYKVVGLAHPKEIREIIKLA
LDGRFTDARKKLRELMINYGLSGTDVIKQIHKEVFGPELKLPDEVRVLIADYAGEIQFRL
VEGADDEIQLNAFLAWLAMLGRKLKGK
Download sequence
Identical sequences G0ECN3
WP_014027280.1.63292 gi|347524285|ref|YP_004781855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]